DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and cid-1

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_498099.1 Gene:cid-1 / 175707 WormBaseID:WBGene00019629 Length:1425 Species:Caenorhabditis elegans


Alignment Length:308 Identity:79/308 - (25%)
Similarity:133/308 - (43%) Gaps:72/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VRNCIEKEMRGRVRVFPFGSLVTGLALKESDIDLFLE-PNGNQPP--LFHNQLYNKTSHFLRRSK 169
            :::.:.|..|..|.:..|||::|||::..||||:.|. .:|:.||  |...::..||...||:..
 Worm  1037 LQSFLRKNYREDVTLTTFGSVMTGLSVNCSDIDICLRFGDGDVPPKDLTAKEVIQKTESVLRKCH 1101

  Fly   170 CFADVFTIRHASVPIIRCKHQLTG---LNIDINMSNPNSIYNSRFVGE--LMFRNERIRELCLFL 229
            ....|..|..|.|||::.:.:|:.   :::||:..|..:|||:..:.|  |...::|..:|.||:
 Worm  1102 LVKRVQAIVTAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYSLWTPDKRFAKLALFV 1166

  Fly   230 KIWAKKLKL--ISHGGMTSYCLISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYSLD---- 288
            |.|||..::  .|.|.::|||.:.::|..||             .|.|.:|..:...:..|    
 Worm  1167 KTWAKNCEIGDASRGSLSSYCHVIMLISYLQ-------------NCDPPVLPRLQEDFRSDNRER 1218

  Fly   289 ----------------LTPPIPA-RLTTLDLLKNFFIYYCTVNFDKSVLSPFLGGCVDKETTLGM 336
                            |....|. :.:...||..:|.||...:|...|:.     |..:.....|
 Worm  1219 RLVDNWDTSFAQVETSLLQRWPKNKESCAQLLIGYFDYYSRFDFRNFVVQ-----CRREMILSKM 1278

  Fly   337 PGGFPEYDEQQKLVHDAIGAPPDAFQLDRAMCVQDPFELSRNVAKSVS 384
            ...:|                       |.:||:|||:||.|::..|:
 Worm  1279 EKEWP-----------------------RPLCVEDPFDLSHNLSSGVN 1303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 36/115 (31%)
cid-1NP_498099.1 PAP_assoc 574..625 CDD:367682
NT_PAP_TUTase 1029..1151 CDD:143392 36/113 (32%)
TRF4 1034..>1317 CDD:227585 79/308 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.