DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and pup-3

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_491621.1 Gene:pup-3 / 172207 WormBaseID:WBGene00019082 Length:482 Species:Caenorhabditis elegans


Alignment Length:286 Identity:68/286 - (23%)
Similarity:119/286 - (41%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 FPFGSLVTGLALKESDIDLFLEP---NGNQPPLFHNQLYNKTSHFLRRSKCFADVFT---IRHAS 181
            |..||...|:.:..||||..::.   .|..|.|...||..:.|       |:..:|:   ::..:
 Worm   103 FITGSYPAGVDIFSSDIDFTVKVPTLEGANPFLKLMQLRKELS-------CYYTIFSKAYVQKGN 160

  Fly   182 VPIIRCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRELCLFLKIWAKK--LKLISHGGM 244
            :|:::..|..|.::||:.:.|..|..|::.:......:.|...||..:|.||..  ::..|.|.:
 Worm   161 IPVLQLMHAETKVSIDVTIDNDTSKRNTQLLAFYSQLDTRFPLLCKAMKAWAASCGVEGASRGRL 225

  Fly   245 TSYCLISLIIVNLQVNRLVPSVKEL-QSLCPPVILSGVNYAYSLDLTPPIPARLTTLDLLKN--- 305
            .|:.|..::|..||..:::.:::|: ..|...:::...|| ...||...|..: ...|..:|   
 Worm   226 NSFSLCLMLIHYLQTVQVLLNIQEIFPELNGDIVVEDDNY-MKRDLKIEILEK-GAFDFNQNTSS 288

  Fly   306 -------FFIYYCTVNFDKSVLSPFLGGCVDKE-TTLGMPGGFPEYDEQQKLVHDAIGAPPDAFQ 362
                   |..||...||..:.:|...|..:.|: :...:|..               |.|.|.  
 Worm   289 LAVLFIGFMKYYSEFNFKWNWISIKHGNVLKKKWSKTRVPKN---------------GMPKDC-- 336

  Fly   363 LDRAMCVQDP-FELSRNVAKSVSISN 387
              |.:.|.|| .|:.||.|.:|...|
 Worm   337 --RFIVVADPLLEIPRNCAGTVRQQN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 24/98 (24%)
pup-3NP_491621.1 TRF4 90..>374 CDD:227585 68/286 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.