DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mkg-p and TENT4A

DIOPT Version :9

Sequence 1:NP_001286981.1 Gene:mkg-p / 38955 FlyBaseID:FBgn0035889 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_008930.2 Gene:TENT4A / 11044 HGNCID:16705 Length:792 Species:Homo sapiens


Alignment Length:271 Identity:69/271 - (25%)
Similarity:105/271 - (38%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 FGSLVTGLALKESDIDLFLEPNGNQPPLFHNQLYNKTSHFLRR----SKCFADVFTIRHASVPII 185
            |||..|||.|..|||||.:.....:|||   ||..:.   ||:    ..|  .:..:..|:||||
Human   284 FGSFSTGLYLPTSDIDLVVFGKWERPPL---QLLEQA---LRKHNVAEPC--SIKVLDKATVPII 340

  Fly   186 RCKHQLTGLNIDINMSNPNSIYNSRFVGELMFRNERIRELCLFLK--IWAKKLKLISHGGMTSYC 248
            :...|.|.:.:||:.:....:..:.|:...|.:...:..|.|.||  :..:.|..:..||::||.
Human   341 KLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGGISSYS 405

  Fly   249 LISLIIVNLQVNRLVPSVKELQSLCPPVILSGVNYAYSLDLTPPIPARLTTLD---LLKNFF-IY 309
            ||.:.|..||                              |.|.|.||....:   ||..|| :|
Human   406 LILMAISFLQ------------------------------LHPRIDARRADENLGMLLVEFFELY 440

  Fly   310 YCTVNFDKSVLSPFLGGC-VDKETTL-GMPGGF-PEYDEQQKLVHDAIGAPPDAFQLDRAMCVQD 371
            ....|:.|:.:....||. :.||..: .|..|: |.                       .:|::|
Human   441 GRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPS-----------------------MLCIED 482

  Fly   372 PFELSRNVAKS 382
            |.....:|.:|
Human   483 PLLPGNDVGRS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mkg-pNP_001286981.1 NT_PAP_TUTase 104..216 CDD:143392 30/94 (32%)
TENT4ANP_008930.2 PAP_assoc 240..>545 CDD:332051 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.