DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7120 and CG6236

DIOPT Version :10

Sequence 1:NP_001246667.1 Gene:CG7120 / 38954 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster
Sequence 2:NP_650446.2 Gene:CG6236 / 41857 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster


Alignment Length:214 Identity:37/214 - (17%)
Similarity:65/214 - (30%) Gaps:85/214 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FDKVKFDYPHEYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFALPKSGSK--- 134
            |:|.|..|..:||...:..:...|:        :|:|...|              |.:...|   
  Fly   736 FNKKKKYYTTKYLQKHSALFDQLDL--------VTYEEVMR--------------LSQYRRKTLV 778

  Fly   135 IIGFHGKAGWYLDAIGVH------TQPIPKENNPSSKILLHSHQSFSQGDKKHEYSVLQGSVGQN 193
            ::|.||....::....:|      ..|||....|..|         .:.|.||.|.         
  Fly   779 LLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRK---------DEVDGKHYYF--------- 825

  Fly   194 FDIVVTLRKKDPTLPSFESRDSAGAEVTKHKLVTDTEKSQSKIEGGAKTYGPWGGTGGIMFDDGI 258
                                      ||..:::.|.:.::         |..:|.....|:...:
  Fly   826 --------------------------VTNEQMMADIQNNE---------YLEYGTHEESMYGTKL 855

  Fly   259 YTGIRQINLSRNVGIVSMK 277
            .| ||.|:.|..:.|:.::
  Fly   856 ET-IRNIHKSGKIAILDVE 873

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7120NP_001246667.1 DUF229 130..622 CDD:397236 26/157 (17%)
CG6236NP_650446.2 DUF229 73..581 CDD:397236
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.