DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and f7

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:265 Identity:68/265 - (25%)
Similarity:114/265 - (43%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG--DADSVT 89
            |:..:...:.:.||..|....:|:.|:...|.::..:.|||::||.:||:||.||:.  ..:.:|
 Frog   199 KIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEIFICGGTLIAPNWVITAAHCLKPLPENKLT 263

  Fly    90 VYFGATWRTNAQFTHWVGN----------GNFIKH---------SSADIALIRI-PHVDFWHMVN 134
            |..|         .|.:|.          ...|.|         :..||||::: ..|::...|.
 Frog   264 VVLG---------EHRIGTPEGTEQESKVSKIIMHEHYYGSKTNNDNDIALLKLTTPVNYTDYVV 319

  Fly   135 KVELPS--------YNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC-SGYYGS 190
            .:.||.        .:.||       :...|||...:....|:.||.|.|..:...:| .....:
 Frog   320 PLCLPEKQFAVQELLSIRY-------STVSGWGRLLESGATPELLQRVQLPRVKTQDCIRQTQMN 377

  Fly   191 VGDNILCVRTPDG-KSTCGGDSGGPLVT-HDGTK-LVGVTNFGSVAGCQSGAPAG-FQRVTYHLD 251
            :..|:.|....|| |.:|.||||||..| :..|. |.|:.::|  .||......| :.||:.:.:
 Frog   378 ISQNMFCAGYTDGSKDSCKGDSGGPHATQYKNTHFLTGIVSWG--LGCAKKEKYGVYTRVSRYTE 440

  Fly   252 WIRDH 256
            ||:::
 Frog   441 WIKEN 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/248 (26%)
Tryp_SPc 40..256 CDD:238113 66/250 (26%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209
Tryp_SPc 212..445 CDD:238113 66/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.