DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss36

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:250 Identity:84/250 - (33%)
Similarity:112/250 - (44%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC------IGDADSVTVYF----- 92
            ||..|..|..|..|:.|.|...||..||||:||..|||:|.||      :..||.::|..     
Mouse    47 RIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVHSQ 111

  Fly    93 -----GATWRTNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEW 151
                 ||..|:.|  |..:.:........||:||:|:.. ......|..|.||..:..:......
Mouse   112 DGPLEGAHMRSVA--TILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFAHGTAC 174

  Fly   152 WAVACGWGGTYDG--SPLPDYLQCVDLQIIHNSECSGYYGSVG---------DNILCVRTPDG-K 204
            ||.  |||...:.  .|||..||.|:|:::..:.|...|...|         ..:||...|.| :
Mouse   175 WAT--GWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPAGRR 237

  Fly   205 STCGGDSGGPLVTHDGTK--LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDH 256
            .||.||||||||..||.:  |.|:|:||  .|| :...|..|..|..:..|||:|
Mouse   238 DTCQGDSGGPLVCEDGGRWFLAGITSFG--FGCGRRNRPGVFTAVAPYESWIREH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 80/245 (33%)
Tryp_SPc 40..256 CDD:238113 82/247 (33%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 82/247 (33%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.