DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Ctrc

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:291 Identity:77/291 - (26%)
Similarity:116/291 - (39%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILA--LAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF--SGGW-- 63
            |.:||  ||.||:.|           .|....::..|:..|..|.....|:.|.|.:  ...|  
Mouse     4 ITVLAAILACASSCG-----------DPTFPPNLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRH 57

  Fly    64 WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNF----------------- 111
            .||||:|....||||.|||                |...|:.||.|.:                 
Mouse    58 TCGGSLITTSHVLTAAHCI----------------NTNLTYRVGLGKYNLTVEDEEGSVYAEVDT 106

  Fly   112 -IKHSS-------ADIALIRIPH-VDFWHMVNKVELPSYNDRY-NDYNEWWAVACGWGGTYDGSP 166
             ..|..       .|||:|::.. |:....:....:|..:... .||.   ....|||..:...|
Mouse   107 IYVHEKWNRLLLWNDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYP---CYVTGWGRLWTNGP 168

  Fly   167 LPDYLQCVDLQIIHNSECS---GYYGSVGDNILCVRTPDGKSTCGGDSGGPL--VTHDGT-KLVG 225
            :.:.||.....|::::.||   .::..|.:.::|.......|.|.|||||||  ...||. ::.|
Mouse   169 IAEVLQQGLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQVHG 233

  Fly   226 VTNFGSVAGCQS-GAPAGFQRVTYHLDWIRD 255
            :.:|||..||.: ..|..|.||:.::|||::
Mouse   234 IVSFGSSRGCNTYKKPVVFTRVSAYIDWIKE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/251 (26%)
Tryp_SPc 40..256 CDD:238113 67/254 (26%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 66/251 (26%)
Tryp_SPc 30..265 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.