DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss8

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:249 Identity:74/249 - (29%)
Similarity:108/249 - (43%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVY---FGA--- 94
            :|.|||.|..|:.|:.|:.|.:.:.|...||||::::.||::|.||.....|...|   .||   
Mouse    41 IQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAHQL 105

  Fly    95 TWRTNAQFTHWVGNGNFIKHSS-------ADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEW 151
            ...:|....|.|  ...|.|||       .||||||:.. |.|...:..:.||:.|..:.  |..
Mouse   106 DSYSNDTVVHTV--AQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFP--NGL 166

  Fly   152 WAVACGWGGTYDGSPL--PDYLQCVDLQIIHNSECSGYYG---------SVGDNILCV-RTPDGK 204
            .....|||.......|  |..||.:::.:|....||..|.         ::..::||. ....||
Mouse   167 HCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGK 231

  Fly   205 STCGGDSGGPL-VTHDGT-KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
            ..|.||||||| ...:|. .|.|:.::|...|..: .|..:...:.:..||..|
Mouse   232 DACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPN-RPGVYTLTSTYASWIHHH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/241 (29%)
Tryp_SPc 40..256 CDD:238113 71/243 (29%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.