DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss4

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012822151.1 Gene:tmprss4 / 733869 XenbaseID:XB-GENE-940762 Length:785 Species:Xenopus tropicalis


Alignment Length:251 Identity:75/251 - (29%)
Similarity:108/251 - (43%) Gaps:48/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG----DADSVTVYFG 93
            |...|.||..|..::..|.|:.|.|.:.|...|||||:...|:|.|.||..    ..|...|.:|
 Frog   545 TGHKQERIIGGSNSDILKYPWQVSLQYMGQHICGGSILNSRWILCAAHCFDRGQRQVDRWRVQYG 609

  Fly    94 ATWRTNAQFTHWVG--------NGNFIKHSSA-DIALIRI-PHVDFWHMVNKVELPSYNDR---- 144
            .|     ..|:..|        |..::..... ||||::: ..:.....|..|.||.|::.    
 Frog   610 IT-----TLTYLFGTFVDKIFLNSKYVTDQKPNDIALLQLKSDIVASASVQPVCLPGYDNNLVVG 669

  Fly   145 ---YNDYNEWWAVACGWGGTYD-GSPLPDYLQCVDLQIIHNSECSGYY-GSVGDNILCV-RTPDG 203
               |         ..|||.|.: |:.|...||.|.:.:|.::.|:..| |.:.|.:||. :...|
 Frog   670 AVLY---------VTGWGHTVEGGAALASQLQEVAISLISSTTCNQEYGGQILDTMLCAGKIAGG 725

  Fly   204 KSTCGGDSGGPLVT---HDGTKLVGVTNFGSVAGCQSGAP---AGFQRVTYHLDWI 253
            ..||.||||||||:   ....:.||:.::|.  ||  |.|   ..:..|...|:||
 Frog   726 ADTCQGDSGGPLVSLGQSSHWEQVGIVSWGD--GC--GRPNRVGVYTDVQSFLNWI 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/243 (29%)
Tryp_SPc 40..256 CDD:238113 72/244 (30%)
tmprss4XP_012822151.1 ATF7IP_BD <110..233 CDD:293393
PHA03193 <206..340 CDD:177555
LDLa 402..434 CDD:238060
SRCR_2 453..545 CDD:292133 75/251 (30%)
SRCR 464..541 CDD:278931
Tryp_SPc 551..777 CDD:214473 71/243 (29%)
Tryp_SPc 552..777 CDD:238113 70/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.