DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TPSAB1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:286 Identity:88/286 - (30%)
Similarity:122/286 - (42%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAV--ASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW--- 64
            :.:|||.|  :.|..|..|..|.:::          .|..|..|...|.|:.|.|...|.:|   
Human     4 LLLLALPVLASRAYAAPAPGQALQRV----------GIVGGQEAPRSKWPWQVSLRVHGPYWMHF 58

  Fly    65 CGGSIIAHDWVLTAEHCIG-DADSVTVYFGATWRTNAQFTHWVGNGNFIKHS------------- 115
            ||||:|...|||||.||:| |...:     |..|...:..|.......:..|             
Human    59 CGGSLIHPQWVLTAAHCVGPDVKDL-----AALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQI 118

  Fly   116 SADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS--PLPDYLQCVDLQ 177
            .|||||:.:.. |:....|:.|.||..::.:......|..  |||...:..  |.|..|:.|.:.
Human   119 GADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVT--GWGDVDNDERLPPPFPLKQVKVP 181

  Fly   178 IIHNSECSGYY---GSVGDNILCVRTP------DGKSTCGGDSGGPLVTH-DGTKL-VGVTNFGS 231
            |:.|..|...|   ...||::..||..      ..:.:|.||||||||.. :||.| .||.::|.
Human   182 IMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGE 246

  Fly   232 VAGC-QSGAPAGFQRVTYHLDWIRDH 256
              || |...|..:.||||:||||..:
Human   247 --GCAQPNRPGIYTRVTYYLDWIHHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 78/245 (32%)
Tryp_SPc 40..256 CDD:238113 80/247 (32%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 79/245 (32%)
Tryp_SPc 31..267 CDD:214473 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.