DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and C1S

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:274 Identity:69/274 - (25%)
Similarity:108/274 - (39%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC 81
            |..:|:.......|....:.:.||..|..|:....|:.|   |....|.||::|...|||||.|.
Human   415 GPELPKCVPVCGVPREPFEEKQRIIGGSDADIKNFPWQV---FFDNPWAGGALINEYWVLTAAHV 476

  Fly    82 IGDADSVTVYFGATWRTNAQ------------FTH--W------VGNGNFIKHSSADIALIRIPH 126
            :......|:|.|:|....::            |.|  |      .|..||    ..||||:|:..
Human   477 VEGNREPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNF----DNDIALVRLKD 537

  Fly   127 -VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS----------PLPDYLQCVDLQIIH 180
             |.....|:.:.||..:..||..:....:..|||.|....          |:....:|.::::..
Human   538 PVKMGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEK 602

  Fly   181 -NSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVT---HDGTKL--VGVTNFGSVAGCQSGA 239
             .::...|..:  .|::|.....|..:|.|||||....   :|.||.  .|:.::|.    |.|.
Human   603 PTADAEAYVFT--PNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGP----QCGT 661

  Fly   240 PAGFQRVTYHLDWI 253
            ...:.||..::|||
Human   662 YGLYTRVKNYVDWI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 64/250 (26%)
Tryp_SPc 40..256 CDD:238113 65/251 (26%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037 2/5 (40%)
Tryp_SPc 438..678 CDD:238113 65/251 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.