DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TMPRSS2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:242 Identity:71/242 - (29%)
Similarity:104/242 - (42%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI--------------GDADS 87
            |.||..|..|..|..|:.|.|.......||||||..:|::||.||:              |....
Human   290 QSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQ 354

  Fly    88 VTVYFGATWRTNAQFTHWVGNGNF-IKHSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNE 150
            ..:::||.::.....:|    .|: .|..:.||||:::.. :.|..:|..|.||:..........
Human   355 SFMFYGAGYQVEKVISH----PNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQL 415

  Fly   151 WWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNI-----LCVRTPDGK-STCGG 209
            .|  ..|||.|.:.....:.|....:.:|....|:..|  |.||:     :|.....|. .:|.|
Human   416 CW--ISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRY--VYDNLITPAMICAGFLQGNVDSCQG 476

  Fly   210 DSGGPLVTHDGT--KLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            ||||||||....  .|:|.|::||  || ::..|..:..|....|||
Human   477 DSGGPLVTSKNNIWWLIGDTSWGS--GCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/238 (29%)
Tryp_SPc 40..256 CDD:238113 69/239 (29%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133
Tryp_SPc 292..521 CDD:214473 68/238 (29%)
Tryp_SPc 293..524 CDD:238113 69/239 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.