DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss22

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:277 Identity:81/277 - (29%)
Similarity:128/277 - (46%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASGATMPRLATEKLTPVHTKDMQ-GRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69
            :||.|.|...|.|.: ..||.:::|...|..| .||..|..:.:.:.|:.|.:..:|...|.||:
Mouse    74 SILILLVLLTSTAPI-SAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSL 137

  Fly    70 IAHDWVLTAEHCIG---DADSV-TVYFGATWRTNA--QFTHWVGNGNFIKH--------SSADIA 120
            :.:.||:||.||..   |..|: :|..|| |:..:  ..:..||....:.|        :.||||
Mouse   138 LTNRWVVTAAHCFKSNMDKPSLFSVLLGA-WKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIA 201

  Fly   121 LIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL--PDYLQCVDLQIIHNS 182
            |:|:.| :.|...:..:.||..:.|.....:.|  ..|||...||.||  |..||.:.:.||.:.
Mouse   202 LVRLEHSIQFSERILPICLPDSSVRLPPKTDCW--IAGWGSIQDGVPLPHPQTLQKLKVPIIDSE 264

  Fly   183 ECSGYY------GSVGDNILCVRTPDG-KSTCGGDSGGPLV--THDGTKLVGVTNFGSVAGC-QS 237
            .|...|      .::.:.:||....:| :..|.|||||||:  ..|...|.|:.::|.  || :.
Mouse   265 LCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGE--GCAER 327

  Fly   238 GAPAGFQRVTYHLDWIR 254
            ..|..:..:..|..|::
Mouse   328 NRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/240 (29%)
Tryp_SPc 40..256 CDD:238113 69/242 (29%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.