DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss11a

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:250 Identity:72/250 - (28%)
Similarity:105/250 - (42%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
            ||.:|.||.:|..|:.|.|..:....|||::|.:.||:||.||              :||||...
  Rat   155 RIVSGNPAAKGAWPWQVSLQRNNIHQCGGTLIGNMWVVTAAHC--------------FRTNANPR 205

  Fly   104 HWVGN--------------GNFIKHS-------SADIALIRI-PHVDFWHMVNKVELPSYNDRYN 146
            .|..:              ...|.|.       ..||||::. |.|.|...|.::.||..:..:.
  Rat   206 QWTLSFGTTINPPLMKREVRRIIMHEKYRPPARDHDIALVQFSPRVTFSDEVRRICLPEPSASFP 270

  Fly   147 DYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSG---YYGSVGDNILCVRTPDG-KSTC 207
            ..:..:..  |:|..|.|....:.|:...:|||.|..|..   |...:...:.|....:| ...|
  Rat   271 PNSTVYIT--GFGALYYGGESQNELREARVQIISNDVCKQRHVYGNEIKRGMFCAGFLEGIYDAC 333

  Fly   208 GGDSGGPLVTHDGTK---LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            .||||||||..|...   |:|:.::|...| |...|..:.:|||:..||...||:
  Rat   334 RGDSGGPLVVRDDKDTWYLIGIVSWGDNCG-QKNKPGVYTQVTYYRRWIASKTGL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/242 (28%)
Tryp_SPc 40..256 CDD:238113 69/244 (28%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 69/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.