DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC683849

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:280 Identity:87/280 - (31%)
Similarity:124/280 - (44%) Gaps:71/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSII 70
            |:|.||:          :.|....||...|   :|..||..:|...||.|.|. ||..:||||:|
  Rat     3 ALLILAL----------VGTAVAFPVDDDD---KIVGGYTCQENSVPYQVSLN-SGYHFCGGSLI 53

  Fly    71 AHDWVLTAEHC--------IGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHS-------SADIA 120
            ...||::|.||        :|: .::.|..|     |.||   |.....|||.       :.||.
  Rat    54 NDQWVVSAAHCYKSRIQVRLGE-HNINVLEG-----NEQF---VNAAKIIKHPNFDRKTLNNDIM 109

  Fly   121 LIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVAC----------GWGGTYD-GSPLPDYLQC 173
            ||::.. |.....|..|.|||              :|          |||.|.. |...||.|||
  Rat   110 LIKLSSPVKLNARVATVALPS--------------SCAPAGTQCLISGWGNTLSFGVNEPDLLQC 160

  Fly   174 VDLQIIHNSEC-SGYYGSVGDNILCVR-TPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQ 236
            :|..::..::| :.|.|.:.||::|.. ...||.:|.||||||:|.:.  :|.|:.::|  .||.
  Rat   161 LDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNG--ELQGIVSWG--YGCA 221

  Fly   237 -SGAPAGFQRVTYHLDWIRD 255
             ...|..:.:|..::|||.|
  Rat   222 LPDNPGVYTKVCNYVDWIED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/243 (31%)
Tryp_SPc 40..256 CDD:238113 79/246 (32%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 76/243 (31%)
Tryp_SPc 24..242 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.