DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and st14a

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:245 Identity:69/245 - (28%)
Similarity:102/245 - (41%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSG-GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRT-- 98
            :.||..|..|.||:.|:.|.|.... ...||||||...|::||.||:.|...:......||..  
Zfish   594 KSRIVGGQDAFEGEFPWQVSLHIKNIAHVCGGSIINERWIVTAAHCVQDDVKIKYSQPGTWEVFL 658

  Fly    99 --NAQFTHWVGNGNFIKH-----------SSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYN 149
              ::|..........:|.           ...||||:.:.. |.|...:..|.||:..|.:....
Zfish   659 GLHSQKDKLTATKRLLKQVIPHPYYNAYTYDNDIALMEMESPVTFSDTIRPVCLPTATDTFPAGT 723

  Fly   150 EWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY-GSVGDNILCVRT-PDGKSTCGGDSG 212
            .  ....|||.|.:|......||..:::||:::.|:... |.:...:.|... ..|...|.||||
Zfish   724 S--VFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQITSRMTCAGVLSGGVDACQGDSG 786

  Fly   213 GPLVTHDGTK--LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDHTGI 259
            |||....|.:  |.||.::|.  || :...|..:..|.....||::.||:
Zfish   787 GPLSFPSGKRMFLAGVVSWGD--GCARRNKPGIYSNVPKFRAWIKEKTGV 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/235 (28%)
Tryp_SPc 40..256 CDD:238113 66/237 (28%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060
Tryp_SPc 596..828 CDD:214473 65/235 (28%)
Tryp_SPc 597..831 CDD:238113 66/237 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.