DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC595077

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031748571.1 Gene:LOC595077 / 595077 -ID:- Length:752 Species:Xenopus tropicalis


Alignment Length:269 Identity:84/269 - (31%)
Similarity:124/269 - (46%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTPVHTKDMQG------RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAD 86
            :|.|.|....|      ||..|..:::|:.|:.:.|.:...:.||||:|...||:.|.||.   |
 Frog    17 VTVVETTSACGVPVVSDRIVGGMNSKKGEWPWQISLNYKNEFICGGSLITDSWVMAAAHCF---D 78

  Fly    87 SV-----TVYFGATWRTNAQFTHWVGNG--------NFI-KHSSADIALIRI-PHVDFWHMVNKV 136
            |:     |||.|| ::.:|.....|..|        ||: :.||.||||:.: ..|.|...:..|
 Frog    79 SLKVSYYTVYLGA-YQLSALDNSTVSRGVKKIIKNPNFLYEGSSGDIALMELETPVTFTPYILPV 142

  Fly   137 ELPSYNDRYNDYNEWWAVACGWGGTYDGSPL--PDYLQCVDLQIIHNSECSGYYGS--------- 190
            .|||...:.......|..  |||.|.:|.||  |..||..::.||.:|.|...|.|         
 Frog   143 CLPSQEVQLAAGTMCWVT--GWGDTQEGIPLSNPKTLQMAEVGIISSSSCEDMYESSFGYSTGGT 205

  Fly   191 -VGDNILCVRTPDGK-STCGGDSGGPLVTHDGTKLVGVTN----FGSVA---GC-QSGAPAGFQR 245
             :.::::|....:|: ..|.||||||||.:       |.|    ||.|:   || :...|..:.:
 Frog   206 FIQEDMVCAGYQEGQIDACQGDSGGPLVCN-------VNNVWLQFGIVSWGYGCAEPNKPGVYTK 263

  Fly   246 VTYHLDWIR 254
            |.|:.||::
 Frog   264 VQYYQDWLK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 79/249 (32%)
Tryp_SPc 40..256 CDD:238113 79/251 (31%)
LOC595077XP_031748571.1 Tryp_SPc 35..272 CDD:238113 79/249 (32%)
Tryp_SPc 431..670 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.