DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and cbl

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012822121.1 Gene:cbl / 594900 XenbaseID:XB-GENE-6258452 Length:904 Species:Xenopus tropicalis


Alignment Length:78 Identity:16/78 - (20%)
Similarity:30/78 - (38%) Gaps:19/78 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FWHMVNKVELPSYNDRYN---------DYNEWWAVACG------WG----GTYDGSPLPDYLQCV 174
            |.||:.:::....|.::.         |..|:|..|.|      |.    ..:|..|:...|:.:
 Frog   206 FSHMLAELKAIFPNGQFQGDSFRITKADAAEFWRKAFGEKTIVPWKIFRLALHDVHPISSGLEAM 270

  Fly   175 DLQIIHNSECSGY 187
            .|:...:..|:.|
 Frog   271 ALKSTIDLTCNDY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 16/78 (21%)
Tryp_SPc 40..256 CDD:238113 16/78 (21%)
cblXP_012822121.1 Cbl_N 102..223 CDD:280432 4/16 (25%)
Cbl_N2 227..310 CDD:280857 12/57 (21%)
SH2_Cbl-b_TKB 304..400 CDD:198176
zf-C3HC4 429..467 CDD:278524
UBA_c-Cbl 855..894 CDD:270576
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.