DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:273 Identity:88/273 - (32%)
Similarity:115/273 - (42%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGD--ADSVTVYFGATWRTNAQ 101
            ||..|..|..|..|:.|.|....|.:||||:|.:.|||||.|||.|  ..|:.||.| .||:   
Zfish    35 RIVGGVNATHGAWPWMVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLG-KWRS--- 95

  Fly   102 FTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSY------ND----------RYNDY-- 148
               :|.:.|.|..:...|    |||            |||      ||          :|.||  
Zfish    96 ---YVADVNSISRTIRHI----IPH------------PSYSNITKDNDIALLQLTSTVQYTDYIK 141

  Fly   149 ---------------NEWWAVACGWG-------GTYDGS-------PLPDYLQCVDLQIIHNSEC 184
                           |.|.|   |||       |...|.       |.|..||..:|::..|::|
Zfish   142 PICLADENSNFPRGTNSWVA---GWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADC 203

  Fly   185 SGY-YGSVGDNILCVRT-PDGKSTCGGDSGGPLVTHDGTKL-VGVTNFGSVAGC-QSGAPAGFQR 245
            :.. :|.:..|::|..| |.||:|..|||||||:|.....: .||.:.|  .|| |...|..|.|
Zfish   204 NNICHGRITPNMICAGTRPGGKATFSGDSGGPLMTKCSVWVQAGVLSHG--YGCAQPNLPEVFIR 266

  Fly   246 VTYHLDWIRDHTG 258
            |:.:..||..:.|
Zfish   267 VSEYKQWITGNVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 85/266 (32%)
Tryp_SPc 40..256 CDD:238113 86/268 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 84/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.