DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss5

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:241 Identity:76/241 - (31%)
Similarity:113/241 - (46%) Gaps:29/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGD-----ADSVTVYFGATWRT 98
            ||..|..|..|:.|:.|.|.::....||||||.:.|::||.||:.:     ..|..||.|.....
Zfish   311 RIIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSN 375

  Fly    99 NAQFTHWVG----------NGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWW 152
            .|:...:.|          |.|...|.: ||||::: ..::|...:..|.||.|:.......:.|
Zfish   376 LAKLAQYQGFAVERIIYNKNYNHRTHDN-DIALVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCW 439

  Fly   153 AVACGWGGTY-DGSPLPDYLQCVDLQIIHNSECSG---YYGSVGDNILCVRTPDGK-STCGGDSG 212
              ..|||.|. |...:|:.|:...:.:|...:|:.   |.|.:...:||....:|| ..|.||||
Zfish   440 --ISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNGEITSRMLCAGYSEGKVDACQGDSG 502

  Fly   213 GPLVTHDGT--KLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRD 255
            ||||..|..  :||||.::|:  || :...|..:.:|...|.||.|
Zfish   503 GPLVCQDENVWRLVGVVSWGT--GCAEPNHPGVYSKVAEFLGWIYD 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/237 (31%)
Tryp_SPc 40..256 CDD:238113 75/240 (31%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 73/237 (31%)
Tryp_SPc 312..547 CDD:238113 75/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.