DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:278 Identity:94/278 - (33%)
Similarity:131/278 - (47%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL-GFSGGWW 64
            |..::|.:.|.|||        :|..:...:.|.|.:|||.||..|..|:.||.|.| ..:...:
Mosquito     1 MNRWVAFVVLCVAS--------VACGEDAALRTADWEGRIVNGLNAVSGQFPYQVSLTSATYQHF 57

  Fly    65 CGGSIIAHDWVLTAEHCI---GDADSVTVYFGATWRTNAQFTHWVGNGNFIKH-------SSADI 119
            |||:||.:.|:|||.||:   ..|:.:.| .||.......:.:.|  ..||.|       ...||
Mosquito    58 CGGAIIGNHWILTAAHCLTGRKPAEVIAV-VGALTSARGGYNYDV--EQFILHPNFNEWTQQNDI 119

  Fly   120 ALIRIPHVDFWHM-VNKVELPSYNDR-YNDYNEWWAVACGWGGTYDGSPLP-DYLQCVDLQIIHN 181
            ||:|..    |.: .|....|....| |...|. ..:|.|||.|....|.| |.||.|.|:.|.|
Mosquito   120 ALVRTK----WSISFNTAVFPVKMARTYTPANR-AVLASGWGLTTLSVPKPADRLQYVALRTISN 179

  Fly   182 SECSGYY-----GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPA 241
            .:||..:     .::..:|||..:.:.:.||.|||||||| .|| :|||:.::|  ..|..|.|.
Mosquito   180 EDCSERFRKLQNRAITPSILCTFSRNEQGTCMGDSGGPLV-EDG-ELVGIVSWG--IPCAVGYPD 240

  Fly   242 GFQRVTYHLDWIRDHTGI 259
            .:.||:....||...||:
Mosquito   241 VYVRVSSFRAWIGAVTGV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 80/232 (34%)
Tryp_SPc 40..256 CDD:238113 81/234 (35%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 80/232 (34%)
Tryp_SPc 32..252 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.