DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP010618

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001688265.1 Gene:AgaP_AGAP010618 / 5667797 VectorBaseID:AGAP010618 Length:252 Species:Anopheles gambiae


Alignment Length:229 Identity:60/229 - (26%)
Similarity:101/229 - (44%) Gaps:37/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI----GDADSVTVYFGATWRT 98
            |||.||...:..|..:...:.....:.|..||::....|||.||:    |.:|   ::.|.|...
Mosquito    39 GRIVNGTRKDISKYKFMAIVYIQKEYVCSASIVSGSHALTAAHCVTIRGGSSD---IFKGGTLFQ 100

  Fly    99 NAQFT---HWVGNGNFIKH-SSADIALIRI--------PHVDFWHMVNKVELPSYNDRYNDYNEW 151
            ..:.|   :::..|:..:: ...|:|::.:        |::.........||||....|      
Mosquito   101 VVKITVSPNYMRTGSIARNVYDNDVAVLTVATNAFVGKPNIAPISFATSAELPSGTRCY------ 159

  Fly   152 WAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY---GSVGDNILCVRTPDGKSTCGGDSGG 213
               |.|||.|.....|...|...:.:::..::|...|   .::..|::|.:..:.: .|.|||||
Mosquito   160 ---ALGWGRTNFDENLSTKLLYAEFKLVLTADCRKAYSGKANITPNVICGKAKNSE-VCEGDSGG 220

  Fly   214 PLVTHDGTKLVGVTNFGSVAG-CQSGAPAGFQRV 246
            |||..:  ||.|:|.|  |.| |:...||||.::
Mosquito   221 PLVCDN--KLTGITFF--VYGKCKGILPAGFTKI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 59/228 (26%)
Tryp_SPc 40..256 CDD:238113 58/227 (26%)
AgaP_AGAP010618XP_001688265.1 Tryp_SPc 40..250 CDD:214473 59/226 (26%)
Tryp_SPc 41..252 CDD:238113 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.