DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP001249

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001689375.2 Gene:AgaP_AGAP001249 / 5667667 VectorBaseID:AGAP001249 Length:267 Species:Anopheles gambiae


Alignment Length:285 Identity:82/285 - (28%)
Similarity:126/285 - (44%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEK---LTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGG 62
            ||||| :|:|.||.|.......:...|   |....:.:..|||..|......:.||.:.|..:|.
Mosquito     1 MKAFI-LLSLFVAGALAGVEESIWLSKQVRLDAGTSAEYNGRIVGGSTVPISQFPYQLSLRQNGN 64

  Fly    63 WWCGGSIIAHDWVLTAEHC---IGDADSVTVYFGATWRTN-------AQ-FTHWVGNGNFIKHSS 116
            ..||.|:|:.:|.|:|.||   :..|.|::...|:..||.       || ..|...|.|.:.:  
Mosquito    65 HICGASVISSNWALSAAHCTFPMPSAASISFRGGSDSRTGGGVIFQAAQIINHPQYNSNNLNN-- 127

  Fly   117 ADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHN 181
             |:.:|||........:..:.|.:....:.....  :|..|||.|..|..||..|..|::.::..
Mosquito   128 -DVCVIRITTSFVGANIAPIRLVASGTSFAAGTN--SVVSGWGLTSPGGSLPVNLHAVNIPVVAQ 189

  Fly   182 SECSGYYGS--VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAP---- 240
            :.||..:|:  :...::|... .|:.:|.|||||||||  |....||.::|:|   |.|.|    
Mosquito   190 ATCSSQWGTGRITAAMVCAGV-QGRDSCNGDSGGPLVT--GGAQFGVVSWGAV---QCGGPLPGV 248

  Fly   241 ------AGFQRVTYHLDWIRDHTGI 259
                  ||.:      .:|..:||:
Mosquito   249 YANIGNAGIR------SFISQNTGV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/236 (28%)
Tryp_SPc 40..256 CDD:238113 66/238 (28%)
AgaP_AGAP001249XP_001689375.2 Tryp_SPc 41..254 CDD:214473 64/223 (29%)
Tryp_SPc 42..264 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.