DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP001247

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001689376.2 Gene:AgaP_AGAP001247 / 5667666 VectorBaseID:AGAP001247 Length:253 Species:Anopheles gambiae


Alignment Length:249 Identity:64/249 - (25%)
Similarity:108/249 - (43%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI---GDADSVTV 90
            ||:..: :.|||..|.......||:.:.|.......||.|::.....:||.||:   ...:.:|:
Mosquito     7 TPIEVR-VTGRIFGGMETNIKDAPHQLSLRRFDSHICGASVVDASLAITAAHCLTPKPPPEFITL 70

  Fly    91 YFGATWRTNAQ----------FTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYNDRY 145
            ..|:|.||:..          ..|...|.|...:   |:||:||... |....|...:|......
Mosquito    71 MGGSTNRTDYDVGVIFNAIELIIHPGYNSNTFHN---DVALVRIEGT-FGGYENVAPIPLRTRTI 131

  Fly   146 --NDYNEWWAVACGWGGT-YDGSPLPDYLQCVDLQIIHNSECSGYYG--SVGDNILC---VRTPD 202
              :..|..:....|||.| .:|..||:.|:.|.:.::..:||...:.  .:..:::|   :|   
Mosquito   132 FTSSSNPVYCTVSGWGLTNMNGDGLPEILRIVRIPLVPYTECRRKWNPFPITSSMICAGELR--- 193

  Fly   203 GKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
             |..|.||||||||.:.  :|.|:.::|| ..|.|..|..:..:...|.::.::
Mosquito   194 -KDACNGDSGGPLVCNG--QLYGIVSWGS-NQCGSSYPGIYTSIPAVLSFLSEY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/234 (26%)
Tryp_SPc 40..256 CDD:238113 60/236 (25%)
AgaP_AGAP001247XP_001689376.2 Tryp_SPc 16..238 CDD:214473 60/232 (26%)
Tryp_SPc 17..242 CDD:238113 60/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.