DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005690

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001688708.1 Gene:AgaP_AGAP005690 / 5667342 VectorBaseID:AGAP005690 Length:300 Species:Anopheles gambiae


Alignment Length:298 Identity:90/298 - (30%)
Similarity:134/298 - (44%) Gaps:53/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILAL--AVASAS------GATMP---------------RLATEKLTPVHTKDMQGRITN 42
            |::|:.:.|:  |||||.      ....|               ::..||| |.|      ||||
Mosquito     1 MRSFVLLFAVLAAVASAEWIDIDWSTVRPIEEFDHYWERLPAELQVYREKL-PSH------RITN 58

  Fly    43 GYPAEEGKAPYTVGL---GFSGGWWCGGSIIAHDWVLTAEHCIGDADSV-----TVYFGATWRTN 99
            |..|..|:.|:.:.|   ..||...||||::..:::|||.||:....|.     ....||..|..
Mosquito    59 GQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCVVSGASTLASGGVAIMGAHNRNI 123

  Fly   100 AQFTHW---VGNGNFIKHSS-------ADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWA 153
            .:.|..   .......:|.|       .|||.:|: ..:.|...:..:.||..:|. ..:..:..
Mosquito   124 QESTQQRIRFATSGIRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLPGRSDT-RQFGGFTG 187

  Fly   154 VACGWGGTYDGSPLPD-YLQCVDLQIIHNSECSGYYGS-VGDNILCVRTPDGKSTCGGDSGGPL- 215
            ...|:|.|.|.|.... .::.....::.|::|...:|| |.:..:|:....|:|:|.||||||| 
Mosquito   188 TVSGFGRTSDASSATSAVVRFTTNPVMTNTDCIARWGSTVVNQHVCLSGAGGRSSCNGDSGGPLT 252

  Fly   216 VTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            |...||..:||.:||||.||..|.|:.:.|||:.||||
Mosquito   253 VQSGGTMQIGVVSFGSVNGCAIGMPSVYARVTFFLDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 74/235 (31%)
Tryp_SPc 40..256 CDD:238113 75/236 (32%)
AgaP_AGAP005690XP_001688708.1 Tryp_SPc 55..290 CDD:214473 74/235 (31%)
Tryp_SPc 56..290 CDD:238113 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.