DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005688

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001688707.1 Gene:AgaP_AGAP005688 / 5667341 VectorBaseID:AGAP005688 Length:301 Species:Anopheles gambiae


Alignment Length:257 Identity:78/257 - (30%)
Similarity:129/257 - (50%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL--GF-SGGWWCGGSIIAHDWVLTAEHCIG 83
            ||.||.......:..| |||||..|..|:.||.:.|  .| :|...||||::..:::|||.||:.
Mosquito    39 RLPTEMKIYRQRRPFQ-RITNGQEATPGQFPYQIILLSDFPTGTALCGGSVLTRNFILTAAHCVV 102

  Fly    84 DADSVTV-----YFGATWRT----NAQFTHWVGNGNFIKH-----SSA---DIALIRI-PHVDFW 130
            ...:..|     ..||..||    :.|...:..:|  |::     ||.   |||::.: ..:.|.
Mosquito   103 SGTNTVVSGGIAIMGAHNRTIQEASQQRIRYTASG--IRYHPLYVSSTLRYDIAVVLLNSSITFT 165

  Fly   131 HMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS-PLPDYLQCVDLQIIHNSECSGYYGS--VG 192
            ..:..|.||:.:|. ..:..:.....|:|.|.|.| .:...::.....::.|:.|...:||  :.
Mosquito   166 DRIQPVRLPAQSDT-RQFGGFVGTLSGFGRTTDASQSISTVVRFTSNPVMTNANCITRWGSSNIQ 229

  Fly   193 DNILCVRTPDGKSTCGGDSGGPLVTHDGTKL-VGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            |..:|:....|:|:|.|||||||....|..: :||.:|.|:.||::|.|:.:.||:::|:|:
Mosquito   230 DQNVCLSGTGGRSSCNGDSGGPLTVESGGPIQIGVVSFVSIRGCEAGMPSVYSRVSFYLNWV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/238 (30%)
Tryp_SPc 40..256 CDD:238113 72/239 (30%)
AgaP_AGAP005688XP_001688707.1 Tryp_SPc 55..291 CDD:214473 72/238 (30%)
Tryp_SPc 56..292 CDD:238113 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.