DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:249 Identity:85/249 - (34%)
Similarity:126/249 - (50%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPY-TVGLGFSG-GWW--CGGSIIAHDWVLTAEHCIGD--ADSVT---VYFGA 94
            |||||..|..|:.|| .|....:| |::  |||:|:...:||||.||:.|  ..:||   |:.||
Mosquito    59 RITNGQLATAGQFPYQAVVYSEAGDGYYSLCGGTILTTTYVLTAAHCVTDDFDRAVTGGIVFLGA 123

  Fly    95 TWRTNAQFTHW---VGNGNFIKHSS-------ADIALIRIPHVDFWH-MVNKVELPSYNDRYNDY 148
            |.||..|.|..   .||.....|..       .|||.:|:.....:: .|..::||:.:|. ..:
Mosquito   124 TDRTVFQSTQQRMSFGNAGIRVHPQYNSTSIRNDIATVRLDTAAIFNTYVKAIDLPALSDA-RQF 187

  Fly   149 NEWWAVACGWGGTYDGSP-LPDYLQCVDLQIIHNSECSGYYGSV---GDNILCVRTPDGKSTCGG 209
            ..:...|.|:|.|.|..| ..:.|..|...::.|::|:.|:.:.   ..|: |:....|:|.|.|
Mosquito   188 GGFEGTASGFGRTADTVPAASNVLMFVRNPVMTNAQCNAYWSTAVVQAQNV-CLDPYGGRSACHG 251

  Fly   210 DSGGPLVTHD-GTKL-VGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGIAY 261
            ||||||...| |..| ||:.:|.|..||.||||:.:.||:|..|:|..::...:
Mosquito   252 DSGGPLAVQDAGRSLQVGIASFVSANGCTSGAPSVWVRVSYFRDFISQNSNYVF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 84/239 (35%)
Tryp_SPc 40..256 CDD:238113 84/241 (35%)
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 84/239 (35%)
Tryp_SPc 60..300 CDD:238113 84/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.