DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and KLK6

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:279 Identity:72/279 - (25%)
Similarity:111/279 - (39%) Gaps:66/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWC 65
            ||..:.:|:|..|:.:                  :.|.::.:|.|.::...||...|..||...|
Human     1 MKKLMVVLSLIAAAWA------------------EEQNKLVHGGPCDKTSHPYQAALYTSGHLLC 47

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSA------------- 117
            ||.:|...|||||.||              .:.|.|.  ::|..|..:..|:             
Human    48 GGVLIHPLWVLTAAHC--------------KKPNLQV--FLGKHNLRQRESSQEQSSVVRAVIHP 96

  Fly   118 ---------DIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 172
                     ||.|:|:.. .....::..:.|    :|....|.......|||.|.||. .||.:|
Human    97 DYDAASHDQDIMLLRLARPAKLSELIQPLPL----ERDCSANTTSCHILGWGKTADGD-FPDTIQ 156

  Fly   173 CVDLQIIHNSECS-GYYGSVGDNILCVRTPD-GKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGC 235
            |..:.::...||. .|.|.:..|:||..... ||.:|.||||||||.  |..|.|:.::|::...
Human   157 CAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPLVC--GDHLRGLVSWGNIPCG 219

  Fly   236 QSGAPAGFQRVTYHLDWIR 254
            ....|..:..|..:.:||:
Human   220 SKEKPGVYTNVCRYTNWIQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 64/238 (27%)
Tryp_SPc 40..256 CDD:238113 66/240 (28%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.