DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and PRSS8

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:244 Identity:64/244 - (26%)
Similarity:112/244 - (45%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGD---ADSVTVYFGA---- 94
            |.|||.|..|..|:.|:.|.:.:.|...||||:::..|||:|.||...   .::..|..||    
Human    42 QARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLD 106

  Fly    95 TWRTNAQFT---HWVGNGNFIKH-SSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAV 154
            ::..:|:.:   ..:.:.::::. |..||||:::.. :.|...:..:.||:.|..:.  |.....
Human   107 SYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFP--NGLHCT 169

  Fly   155 ACGWGGTYDGSPL--PDYLQCVDLQIIHNSECSGYYG---------SVGDNILCV-RTPDGKSTC 207
            ..|||.......|  |..||.:::.:|....|:..|.         .|.::::|. ....||..|
Human   170 VTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDAC 234

  Fly   208 GGDSGGPL-VTHDGT-KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            .||||||| ...:|. .|.|:.::|...|.:: .|..:...:.:..||:
Human   235 QGDSGGPLSCPVEGLWYLTGIVSWGDACGARN-RPGVYTLASSYASWIQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/239 (26%)
Tryp_SPc 40..256 CDD:238113 62/241 (26%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 61/239 (26%)
Tryp_SPc 45..284 CDD:238113 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.