DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and KLK7

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:267 Identity:81/267 - (30%)
Similarity:118/267 - (44%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQG-RITNGYPAEEGKAPYTVGLGFSGGWWCGGS 68
            |.:|:||:.:|.                 ::.|| :|.:|.|...|..|:.|.|.......|||.
Human    11 ILLLSLALETAG-----------------EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGV 58

  Fly    69 IIAHDWVLTAEHCIGDADSVTVYFGATW---------RTNAQFTHWVGNGNFIKHSSADIALIRI 124
            ::...|||||.||  ..:..||:.|:..         :.:..|.|   .|...:....|:.|:::
Human    59 LVNERWVLTAAHC--KMNEYTVHLGSDTLGDRRAQRIKASKSFRH---PGYSTQTHVNDLMLVKL 118

  Fly   125 -PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP---LPDYLQCVDLQIIHNSECS 185
             .......||.||.|||   |.........|: |||.|  .||   .|..|.|||:::|...:|:
Human   119 NSQARLSSMVKKVRLPS---RCEPPGTTCTVS-GWGTT--TSPDVTFPSDLMCVDVKLISPQDCT 177

  Fly   186 GYYGSVGDN-ILCVRTPDG-KSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTY 248
            ..|..:.:| :||...||. |:.|.||||||||.. || |.|:.::|:....|...|..:.:|..
Human   178 KVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCR-GT-LQGLVSWGTFPCGQPNDPGVYTQVCK 240

  Fly   249 HLDWIRD 255
            ...||.|
Human   241 FTKWIND 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/228 (31%)
Tryp_SPc 40..256 CDD:238113 74/231 (32%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.