DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and PROC

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:252 Identity:66/252 - (26%)
Similarity:110/252 - (43%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TKDMQG----RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAH-DWVLTAEHCIGDADSVTVYF 92
            |:|.:.    |:.:|.....|.:|:.|.|..|......|:::.| .|||||.||:.::..:.|..
Human   316 TEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRL 380

  Fly    93 G-------ATWRTNAQFTHWVGNGNFIKHSS-ADIALIRIPH-VDFWHMVNKVELPSYNDRYNDY 148
            |       ..|..:........:.|:.|.:: .||||:.:.. ......:..:.||.......:.
Human   381 GEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAEREL 445

  Fly   149 NE--WWAVACGWGGTYDGSPLPD-------YLQCVDLQIIHNSECSGYYGS-VGDNILCVR-TPD 202
            |:  ...:..|||  |..|...:       .|..:.:.::.::|||....: |.:|:||.. ..|
Human   446 NQAGQETLVTGWG--YHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGD 508

  Fly   203 GKSTCGGDSGGPLVT--HDGTKLVGVTNFGSVAGCQSGAPAG-FQRVTYHLDWIRDH 256
            .:..|.||||||:|.  |....|||:.::|.  ||......| :.:|:.:||||..|
Human   509 RQDACEGDSGGPMVASFHGTWFLVGLVSWGE--GCGLLHNYGVYTKVSRYLDWIHGH 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/237 (26%)
Tryp_SPc 40..256 CDD:238113 62/239 (26%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 62/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.