DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC562139

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:280 Identity:92/280 - (32%)
Similarity:133/280 - (47%) Gaps:47/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILA-LA-VASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW-W 64
            ||:.||: || :.:|.|..:|     .:.||.|.  ..||.||..|.....|:.|.|..|.|: :
Zfish     2 AFVWILSCLALIGTAYGCGVP-----AIPPVITG--YARIVNGEEAVPHSWPWQVSLQDSTGFHF 59

  Fly    65 CGGSIIAHDWVLTAEHC---------IGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHS----- 115
            ||||:|...||:||.||         :|:.|.         .:||:....:..|...||.     
Zfish    60 CGGSLINEWWVVTAAHCNVRTSHRVILGEHDR---------SSNAEPIQTMTVGKVFKHPNFNMF 115

  Fly   116 --SADIALIRI--PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP-LPDYLQCVD 175
              :.||.||::  |.....| |:.|.|...||.:....:  .|..|||.|...:| .|..||...
Zfish   116 TINNDILLIKLATPAKINTH-VSPVCLAETNDNFPGGMK--CVTSGWGLTKHNAPDTPALLQQAA 177

  Fly   176 LQIIHNSECSGYYGS-VGDNILCVRTPDGKSTCGGDSGGPLVTH-DGT-KLVGVTNFGSVAGCQS 237
            |.::.|.:|..::|: :.|.::|... .|.|:|.||||||||.. ||. .|||:.::|| :.|.:
Zfish   178 LPLLTNEDCKRFWGNKITDLMVCAGA-SGASSCMGDSGGPLVCQKDGVWTLVGIVSWGS-SVCST 240

  Fly   238 GAPAGFQRVTYHLDWIRDHT 257
            .:|..:.|||....|: |.|
Zfish   241 SSPGVYARVTKLRAWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 77/236 (33%)
Tryp_SPc 40..256 CDD:238113 77/238 (32%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 77/236 (33%)
Tryp_SPc 34..259 CDD:238113 78/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.