DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and zgc:112285

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:316 Identity:83/316 - (26%)
Similarity:123/316 - (38%) Gaps:83/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITN-GYPAEEGKA---PYTVGLGFSG--- 61
            |.|:|.|.:    |..:.|.:|....|  ::..|.:|.: .:|.:.|.|   |.||....||   
Zfish     7 FFALLLLLL----GLVLDRASTHAFNP--SRLQQHKILHLDWPKDCGLAHFKPNTVERIVSGNEA 65

  Fly    62 ---GW-W-----------------CGGSIIAHDWVLTAEHCI--GDADSVTVYFGATWR------ 97
               .| |                 |||::|..:|||||.||.  |.|:.     .::||      
Zfish    66 RPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAED-----ASSWRIVLGKH 125

  Fly    98 ------TNAQF---------THWVGNGNFIKHSSA--DIALIR-IPHVDFWHMVNKVELPSYNDR 144
                  |..:|         .|:    .:..||..  ||||:: ...:...:.:....||.....
Zfish   126 QLKRSETAERFFPVKRIYRHEHF----RYPAHSELDYDIALVKAATDIQPSNFIRYACLPRKQIN 186

  Fly   145 YNDYNEWWAVACGWGGTYDGS---PLPDYLQCVDLQIIHNSEC--SGYYGS-VGDNILCVRTPDG 203
            .|..:..|..  |||.|..|.   .|.:.|....|.||....|  ..::|. |.|:::|....|.
Zfish   187 LNPGHYCWVT--GWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDSMICAGFRDT 249

  Fly   204 KST---CGGDSGGPL---VTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            :.|   |.|||||||   |..|..::.|:.:||.:.......|:.|.|...::.||
Zfish   250 EGTPAACQGDSGGPLLCQVGRDRWEVHGIVSFGPIGCTVENKPSVFTRTAAYIPWI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/279 (26%)
Tryp_SPc 40..256 CDD:238113 74/280 (26%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 65/257 (25%)
Tryp_SPc 59..308 CDD:238113 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.