DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC558805

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021329158.1 Gene:LOC558805 / 558805 -ID:- Length:255 Species:Danio rerio


Alignment Length:274 Identity:69/274 - (25%)
Similarity:112/274 - (40%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69
            :.:::||:..|.||.                    |.||..|::....|...:..:|...|||.:
Zfish    11 VTLISLALTGAFGAD--------------------IINGKKAKKSSLLYMASVQINGEHKCGGFL 55

  Fly    70 IAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVG-NGNFIK---------HSS-------A 117
            |...:||||.|| ....:::|..|         ||.:. .|..:|         |.|       .
Zfish    56 IDPSYVLTAAHC-NKQGNMSVILG---------THDISPKGTNVKRYRVQNKHIHPSYKSVKTGK 110

  Fly   118 DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHN 181
            ||.|::: ..|.....|..|.:||.:......::  .:..|||.|...:.:.|.| ..|:..|:.
Zfish   111 DIMLLKLYKKVKIGKDVKLVTIPSKDKPLKPKSK--CLVAGWGKTEKDNTVNDLL-VTDVLTINK 172

  Fly   182 SECSGYYGSVG----DNILCVRTPDGKS-TCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQ-SGAP 240
            :.|...:..:.    |||||....:.|| .|.||||||||.  ..:.||:.:| ::..|. ...|
Zfish   173 TVCQSVWKKINVELPDNILCAGGYETKSGACQGDSGGPLVC--SGQAVGIVSF-NMGRCDYPNTP 234

  Fly   241 AGFQRVTYHLDWIR 254
            ..:.:::.:..||:
Zfish   235 NIYTQISKYTHWIK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 62/237 (26%)
Tryp_SPc 40..256 CDD:238113 64/239 (27%)
LOC558805XP_021329158.1 Tryp_SPc 26..250 CDD:238113 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.