DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and si:dkey-21e2.10

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 / 556860 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio


Alignment Length:245 Identity:77/245 - (31%)
Similarity:114/245 - (46%) Gaps:23/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYF 92
            |.|..|...:..|.:|..|:....||.|.|.|.....||||:|..::||||.||..:.|.:||..
Zfish    12 LVPHLTFTARVGIQDGTEAKPHSRPYMVSLQFYKLHMCGGSLITEEFVLTAAHCWEEDDVLTVVT 76

  Fly    93 GA----------TWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYN 146
            ||          .::..:...|...|...:::   ||.|::: ..|...:.|..:.||  .|..:
Zfish    77 GAHDLRKKAINNVYKVKSYIPHPDFNSKTLEN---DIMLLQLKTKVRLSNNVGLISLP--KDGED 136

  Fly   147 DYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCVRTPDGKSTCGG 209
            ...:......|||..:...|..|.|:..:..|::|:||...:.|  |...::||....|  ||.|
Zfish   137 VKADTLCSVAGWGDLWSKGPETDRLREAETVIVNNAECERRWESDYVASKMICVYGHGG--TCSG 199

  Fly   210 DSGGPLVTHDGTKLVGVTNFGSVAGCQSGA-PAGFQRVTYHLDWIRDHTG 258
            |||||||.  |..:||:|:||....|.|.. |....|::.:|.||.:.||
Zfish   200 DSGGPLVC--GDTVVGITSFGEPYLCNSRLFPDVHTRISAYLPWIHNITG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/227 (31%)
Tryp_SPc 40..256 CDD:238113 72/229 (31%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.