DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and f10

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:263 Identity:64/263 - (24%)
Similarity:114/263 - (43%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL------GFSGGWWCGGSIIAHDWVLT 77
            |:|......:..::..|...||..|....:|:.|:...|      ||     |||:|::.:::||
 Frog   207 TLPERNVTGINILNPNDPNVRIVGGRECSQGECPWQALLVSDEDEGF-----CGGTILSREFILT 266

  Fly    78 AEHCIGDADSVTVYFGATWRTNAQFTHW----------VGNGNFIKHS-SADIALIRIPH-VDFW 130
            |.||:.......|..|   ..|.:.:..          :.:..|:|.: ..|||:|::.. ::|.
 Frog   267 AAHCMNQTKYFKVVVG---ELNTKISEGTESIHKVEKIIMHPRFVKSTYDYDIAVIKLKEAINFT 328

  Fly   131 HMVNKVELPSYNDRYND---YNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC--SGYYGS 190
            ..:....:|  :..:.|   .||..|:..|:|..::.......||.:.:..|....|  |..: :
 Frog   329 ENIIPACIP--DPEFADQVLMNEPDAMVSGFGRIHERGRQASTLQMLQVPYIKRHSCKESSTF-A 390

  Fly   191 VGDNILCVR-TPDGKSTCGGDSGGPLVT-HDGTKLV-GVTNFGSVAGC-QSGAPAGFQRVTYHLD 251
            :.:|:.|.. ..:.|..|.||||||.|| ..||..| |:.::|.  || :.|....:.:|:....
 Frog   391 ITENMFCAGFDTEVKDACQGDSGGPHVTPFKGTYFVTGIVSWGE--GCARKGKFGVYTKVSKLHR 453

  Fly   252 WIR 254
            |::
 Frog   454 WLK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 60/240 (25%)
Tryp_SPc 40..256 CDD:238113 60/242 (25%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209
Tryp_SPc 228..456 CDD:238113 60/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.