DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and ctrl

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:275 Identity:88/275 - (32%)
Similarity:132/275 - (48%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILA--LAVASASGATMPRLATEKLTPVHTKDMQG--RITNGYPAEEGKAPYTVGLGFSGGW 63
            ||:.:|:  ..:.|..|...|     .::||    :.|  ||.||..|..|..|:.|.|..|.|:
 Frog     2 AFLWLLSCIALIGSTYGCGSP-----AISPV----LSGYARIVNGENAVPGSWPWQVSLQDSTGF 57

  Fly    64 -WCGGSIIAHDWVLTAEHC---------IGDADSVTVYFGATWRTNAQ-FTHWVGNGNFIKHSSA 117
             :||||:|:..||:||.||         :|:.|..:.......:|.|: |.|    .|:...:.|
 Frog    58 HFCGGSVISDFWVVTAAHCGVTTAHRVILGEYDRSSPAEPIQTKTIAKVFRH----PNYNSFTIA 118

  Fly   118 -DIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDYLQCVDLQII 179
             ||.|:::.. ..|.::|..|.:.|.:|.:|....  .|..|||.....|.| |:.||.|.|.::
 Frog   119 NDITLLKLSSPASFSNIVAPVCVASSSDAFNGGER--CVTTGWGYVDAASRLTPNKLQQVALPLL 181

  Fly   180 HNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLV--THDGTKLVGVTNFGSVAGCQSGAPAG 242
            .|:||..|:||...|.:......|.|:|.||||||||  .:....|.|:.::|| :.|...:|..
 Frog   182 SNTECQRYWGSKILNTMVCAGASGASSCMGDSGGPLVCQRNGAWVLAGIVSWGS-STCSPSSPGV 245

  Fly   243 FQRVTYHLDWIRDHT 257
            :.||:....|: |.|
 Frog   246 YARVSTLRSWM-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/229 (33%)
Tryp_SPc 40..256 CDD:238113 76/231 (33%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.