DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss11f

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038948844.1 Gene:Tmprss11f / 498345 RGDID:1560675 Length:459 Species:Rattus norvegicus


Alignment Length:279 Identity:77/279 - (27%)
Similarity:120/279 - (43%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSG-GWWCGGSIIAHDWVLT 77
            |:|...:|..:|.:      :.:|||.|    |.||:.|:...|...| |..||.::|::.|:||
  Rat   212 SSSNIPLPASSTTE------RIVQGRET----AMEGEWPWQASLQLIGAGHQCGATLISNTWLLT 266

  Fly    78 AEHCIGDADSVTVYFGATWRTNAQFTHWVGN--------------GNFIKH-------SSADIAL 121
            |.||.             |: |...:.|:..              |..|.|       :..||||
  Rat   267 AAHCF-------------WK-NRDPSKWIATFGTTITPPLVKRSVGRIIIHEEYHRDSNENDIAL 317

  Fly   122 IRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS 185
            .:: ..|:|.::|.:|.||..:.:......  ....|:|...|..|..:.|:...::.|.:..|:
  Rat   318 AQLTSRVEFSNVVQRVCLPDSSMKLPPKTS--VFVTGFGSIVDDGPTQNKLRQARVETIGSDVCN 380

  Fly   186 G---YYGSVGDNILCVRTPDGK-STCGGDSGGPLV--THDGTKLVGVTNFGSVAGCQSGA----P 240
            .   |.|.:...:||....:|| ..|.||||||||  ..|...:||:.::|     ||.|    |
  Rat   381 QKDVYDGLITPGMLCAGFMEGKVDACKGDSGGPLVYDNRDIWYIVGIVSWG-----QSCALPNKP 440

  Fly   241 AGFQRVTYHLDWIRDHTGI 259
            ..:.||:.:.|||...||:
  Rat   441 GVYTRVSKYRDWIASKTGL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/246 (27%)
Tryp_SPc 40..256 CDD:238113 68/248 (27%)
Tmprss11fXP_038948844.1 SEA 80..185 CDD:396113
Tryp_SPc 227..456 CDD:238113 71/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.