DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and ctrb2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:266 Identity:79/266 - (29%)
Similarity:126/266 - (47%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAILALAVASASGATMPRLATEKLTPVHTKDMQG--RITNGYPAEEGKAPYTVGLGFSGGW-WC 65
            |:....:.:.|..|..:|     .:.|:    :.|  ||.||..|..|..|:.|.|....|: :|
 Frog     5 FLLSCIVLIGSTYGCGVP-----AIKPI----ISGYARIVNGENAVSGSWPWQVSLQDRTGFHFC 60

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGATWR-TNAQFTHWVGNGNFIKHSS-------ADIALI 122
            |||::.:.||:||.|| |...|..|..|...| ::|:....:......||.:       .||.|:
 Frog    61 GGSLVNNLWVVTAAHC-GVTTSHRVILGEYDRSSSAEPIQTMSISRVFKHPNYNTNTMINDITLL 124

  Fly   123 RIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDYLQCVDLQIIHNSECS 185
            ::.. ..|...|..|.:|:.::.:|....  .:..|||.....|.| |:.||.|.|.::.|:||.
 Frog   125 KLSSTASFNSRVAPVCIPTSSEVFNSPER--CITTGWGYVDAYSKLSPNKLQQVTLPLLSNTECQ 187

  Fly   186 GYYGS-VGDNILCVRTPDGKSTCGGDSGGPLV-THDGT-KLVGVTNFGSVAGCQSGAPAGFQRVT 247
            .|:|: :...::|... .|.|:|.|||||||| ..:|. .|.|:.::|| :.|...:|..:.||:
 Frog   188 RYWGNKIHSTMICAGA-SGASSCMGDSGGPLVCARNGAWVLAGIVSWGS-STCSPSSPGVYARVS 250

  Fly   248 YHLDWI 253
            ....|:
 Frog   251 TLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/227 (32%)
Tryp_SPc 40..256 CDD:238113 72/228 (32%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.