DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and deltaTry

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:273 Identity:86/273 - (31%)
Similarity:124/273 - (45%) Gaps:44/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWC 65
            |..|:.:|: |||.|.|.|:|    |.|.|    .:.|||..|........|:.:.|..||...|
  Fly     1 MLKFVILLS-AVACALGGTVP----EGLLP----QLDGRIVGGSATTISSFPWQISLQRSGSHSC 56

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNG------NFIKHSS-------A 117
            ||||.:.:.::||.||:   .||:   .:..:..|..::|...|      :|..|..       .
  Fly    57 GGSIYSSNVIVTAAHCL---QSVS---ASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN 115

  Fly   118 DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGG-TYDGSPLPDYLQCVDLQIIH 180
            |||:|:| ..:.|...:..:.|.|.|..    |...|...|||. :|..|.:|..||.|::.|:.
  Fly   116 DIAIIKINGALTFSSTIKAIGLASSNPA----NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVS 176

  Fly   181 NSECS----GYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGC-QSGAP 240
            .|:|:    ||...:...::|. ...||..|.||||||||:  |..||||.::|  .|| .|..|
  Fly   177 QSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVS--GGVLVGVVSWG--YGCAYSNYP 236

  Fly   241 AGFQRVTYHLDWI 253
            ..:..|.....|:
  Fly   237 GVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/233 (30%)
Tryp_SPc 40..256 CDD:238113 71/234 (30%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.