DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and zgc:92590

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:292 Identity:81/292 - (27%)
Similarity:118/292 - (40%) Gaps:91/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFI-AILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW- 63
            ||..: |:|.||||.::                    ..:|..||.......|:.:.|.:..|. 
Zfish     1 MKMIVFALLVLAVACSA--------------------DDKIIGGYECSPNSQPWQIYLTYDNGQR 45

  Fly    64 WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWV----GNGNFIKHSSADIALIRI 124
            |||.|:|...|.::|.||...|:.:||:.|         .|.|    |....||....      |
Zfish    46 WCGASLINDRWAVSAAHCYLVANRLTVHLG---------EHNVAVEEGTEQRIKAEKV------I 95

  Fly   125 PHVDFWHMVNKVELPSYNDRY---ND-----------YNEW-----WAVAC----------GWGG 160
            ||            |.||| |   ||           :|::     ...:|          |||.
Zfish    96 PH------------PKYND-YTLDNDFMLIKLKEPAVFNQYVQPVPLTTSCSSEGEQCLVSGWGN 147

  Fly   161 TYD-GSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPD-GKSTCGGDSGGPLVTHDGTK 222
            ..: |...||.|||::|.::..::|.|.|| .:..|:.|....: ||..|.||||||::.:.  :
Zfish   148 LINTGVVYPDVLQCLNLPVLTRAQCEGAYGWQITKNMFCAGFMEGGKDACQGDSGGPVICNG--E 210

  Fly   223 LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            |.||.::|  .|| .||.|..:..|..:.||:
Zfish   211 LRGVVSWG--YGCADSGYPGVYTEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/251 (29%)
Tryp_SPc 40..256 CDD:238113 73/252 (29%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 72/251 (29%)
Tryp_SPc 21..243 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.