DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:235 Identity:55/235 - (23%)
Similarity:86/235 - (36%) Gaps:40/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GKAPYTVGLGFSGG-WWCGGSIIAHDWVLTAEHCIG--------------DADSVTVYFGATWRT 98
            |:.|:|..|..|.| :.|..|:|:..:|||..|||.              |...|..........
Mosquito    14 GQLPWTALLKTSSGEFACAASLISERYVLTVAHCIKNRNVTFVQLRKKDCDEQGVCTLAPQDIPV 78

  Fly    99 NAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVEL---PSYNDRYNDYNEWWAVACGWG 159
            .....|   :|...:....||||:|: .:|.|.:.|..:.|   |.|....::|     .....|
Mosquito    79 ERAIAH---DGFSARRKLNDIALVRLAQNVSFNNDVLPICLPVAPEYQPAGSNY-----FTARDG 135

  Fly   160 GTYDGSPLPDYLQCVDLQIIHNSECSG-------YYGSVGDNILCVRTPDGKSTCGGDSGGPLVT 217
            ..| .|...|.:...::..:....|..       ....:.::.:|.........|...:|||||.
Mosquito   136 QDY-ASLNTDTISITEVHPLTTENCENRLQELIKRQHKIQESHICGYEAGSFDGCATSAGGPLVA 199

  Fly   218 HD--GTKLV-GVTNFGSVAGCQ-SGAPAGFQRVTYHLDWI 253
            .|  |..:. ||.::| |..|. ...|:.:.||...::||
Mosquito   200 LDRFGRNVQHGVVSYG-VQDCSLENVPSVYTRVESFINWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/233 (23%)
Tryp_SPc 40..256 CDD:238113 55/235 (23%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 53/233 (23%)
Tryp_SPc 14..238 CDD:238113 53/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.