DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CLIPA19

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001237509.2 Gene:CLIPA19 / 4577382 VectorBaseID:AGAP003245 Length:356 Species:Anopheles gambiae


Alignment Length:273 Identity:60/273 - (21%)
Similarity:107/273 - (39%) Gaps:76/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGF-----SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRT 98
            ::|.....:....|:|..:.:     :.|:.|||::|....:|||.||:..       ..|.|:.
Mosquito   103 QLTGAQLTQPDDYPWTALIEYEKPDGTTGFHCGGTLINQGHILTAAHCVSS-------LRAGWKV 160

  Fly    99 N-AQFTHW--------------------------------VGNGNFIKHSSADIALIRIPHV-DF 129
            : .....|                                ..||:|    :.||||||...: :|
Mosquito   161 HRVLLGEWDLSSVLDCAYNVCNNPPIEAKVSKIIVHDGYDAQNGSF----NHDIALIRFEELANF 221

  Fly   130 WHMVNKVELPSYND-RYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSG---YYGS 190
            ...:..:.||..:. .:.:..:.::...|||.:...:.:...|: ::|::.:..|||.   :...
Mosquito   222 PDTIVPICLPIADSIPWENITDGFSTVVGWGKSQSTAGVTKKLK-LNLKVRNFRECSSLLEWPEK 285

  Fly   191 VGDNILC-VRTPDGKSTCGGDSGGPLV-----THDGTKLVGVTNFGSVAG-----CQSG-APAGF 243
            :..:.|| :.....:..|..|:||.|.     .|   .|:|      |||     |.|| .|..|
Mosquito   286 MQPSQLCALWERSNRKICSADAGGGLAWFYRRFH---YLIG------VAGSDEQKCGSGDVPGVF 341

  Fly   244 QRVTYHLDWIRDH 256
            ..|:|:::||||:
Mosquito   342 VNVSYYMNWIRDN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 56/268 (21%)
Tryp_SPc 40..256 CDD:238113 59/270 (22%)
CLIPA19XP_001237509.2 CLIP 37..84 CDD:197829
Tryp_SPc 106..354 CDD:238113 58/268 (22%)
Tryp_SPc 106..351 CDD:214473 55/265 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.