DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:275 Identity:93/275 - (33%)
Similarity:130/275 - (47%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFIAILALAVASASGATMPRLATEKLTPVHTKD-MQGRITNGYPAEEGKAPYTVGLGFSG-GWW 64
            |.|..:..|.|.||:          |:|.:...| ...|:..|..|:.|.|||.|.|...| |..
Mosquito     4 KVFAVVSVLLVVSAA----------KVTKLVLDDHYVNRVVGGEVAKNGSAPYQVSLQVPGWGHN 58

  Fly    65 CGGSIIAHDWVLTAEHC-IG-DADSVTVYFGATWRTNAQFTHWVGNGNFIK------HS------ 115
            ||||::.:.|||||.|| :| :...:.|..|    ||:    ....|..:|      ||      
Mosquito    59 CGGSLLNNRWVLTAAHCLVGYEPSDLMVLVG----TNS----LKEGGELLKVDKLLYHSRYNRPQ 115

  Fly   116 -SADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQI 178
             ..||.|:|:.. |.|..:|..||   |.::....|....:. |||.|.....:|..||.:::..
Mosquito   116 FHNDIGLMRLEQPVQFSELVQSVE---YLEKAVPVNATVRLT-GWGRTSTNGNVPTLLQSLNVVT 176

  Fly   179 IHNSECSGYYGSVGDNI----LCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGA 239
            :.|.:|....|: .:|:    :|..|..|:..|.|||||||| ::| |||||.|||  ..|..|.
Mosquito   177 LSNEDCKAKMGN-PENVDLGHVCTLTKAGEGACNGDSGGPLV-YEG-KLVGVVNFG--VPCGRGF 236

  Fly   240 PAGFQRVTYHLDWIR 254
            |.||.||:|:.:|:|
Mosquito   237 PDGFARVSYYHEWVR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 82/234 (35%)
Tryp_SPc 40..256 CDD:238113 83/236 (35%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 82/234 (35%)
Tryp_SPc 33..253 CDD:238113 83/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.