DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005587

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001237684.2 Gene:AgaP_AGAP005587 / 4576204 VectorBaseID:AGAP005587 Length:296 Species:Anopheles gambiae


Alignment Length:268 Identity:54/268 - (20%)
Similarity:91/268 - (33%) Gaps:84/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TNGYPAEEGKAPYTVGLGFSG----GW-----WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATW 96
            ::||....|:.||...:..:.    .|     ...||:|..:::||:...:              
Mosquito    64 SDGYEIYAGQFPYHALVYINNENPKPWESSIVQTAGSLITPNYILTSAEVL-------------- 114

  Fly    97 RTNAQFTHWVGNG---NFIK---HSSAD---------------------------IALIRIPH-V 127
            |.|.     :|||   .|::   .:.||                           ||.||:.| .
Mosquito   115 RKNI-----LGNGKTYGFVELGYRNGADRERQQVIDFTNSSISIHPRFSGGLFYNIATIRLEHPA 174

  Fly   128 DFWHMVNKVELPSYNDRYNDYNEWWAVACG--WGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS 190
            .....|..:.||..:|     |..:.:..|  .|..|:|:     ::.:..|::.:..|      
Mosquito   175 TLNRYVQPIRLPRLSD-----NRTFEMMEGTSLGHHYNGT-----MRYMRNQVLPHDNC------ 223

  Fly   191 VGDNILCVRTPDGKSTCGGDSGGPLVT--HDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            :....:|..:..|.:.|....|..|..  .||..|:|.|.  .|..|.........||:.:.|||
Mosquito   224 LLQEYVCTNSFIGGAFCNRVDGAGLTVEDEDGPILIGFTM--RVYWCDLNERDINTRVSVYRDWI 286

  Fly   254 RDHTGIAY 261
            .||:...:
Mosquito   287 VDHSDYVF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 50/258 (19%)
Tryp_SPc 40..256 CDD:238113 52/261 (20%)
AgaP_AGAP005587XP_001237684.2 Tryp_SPc 54..286 CDD:214473 50/258 (19%)
Tryp_SPc 66..289 CDD:304450 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.