DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005592

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001237685.2 Gene:AgaP_AGAP005592 / 4576199 VectorBaseID:AGAP005592 Length:299 Species:Anopheles gambiae


Alignment Length:311 Identity:70/311 - (22%)
Similarity:114/311 - (36%) Gaps:78/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASAS---GATMP-------RLATEKLTPV--------HTKDMQGRI-TNGYPA 46
            ||:|:|.:.|.|...|   |..:.       ::....::||        .:::.:.|: |.||.|
Mosquito     1 MKSFVAAVVLCVLCVSVIGGVVLDDVERSPVKIPINHISPVTETAQNQSRSEEEENRLSTYGYLA 65

  Fly    47 EEGKAPYTV-------GLGFSGGWWCGGSIIAHDWVLTAEHCI------GDADSVTVYFGATWRT 98
            ..|:.||..       .|.:...  |.||:|...:|||...|:      .|.:...|..|:.:..
Mosquito    66 FPGQFPYHAEVLIKPKSLSYLHS--CAGSLITLKYVLTTAACLYRWVNENDIEYAFVTLGSLFNG 128

  Fly    99 NAQFTHWVGNGNFI-------------KHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNE 150
            :   |.|....||.             .:...:||.|   |:|....:|:...|....|..|...
Mosquito   129 D---TQWEQRINFTDDGIHTHPLYSKPNYEFNNIATI---HLDCPATLNRFVQPIRLPRLTDMRT 187

  Fly   151 WWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNIL----------CVRTPDGKS 205
            :..:.    ||..|:.....|:.:..|::.|.:|.       .:||          |..:..|..
Mosquito   188 YEMME----GTASGAKFIGGLKYLRNQVMSNEDCQ-------RDILPVFIITAQHICTNSLIGGV 241

  Fly   206 TCGGDSGGPLVTHD--GTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            .|..:.|..|...|  |..|:|..::  :..|.|..|....||:|..|||:
Mosquito   242 FCNREFGSSLTVEDQNGRVLIGFADY--LFLCDSNYPTRHVRVSYFRDWIQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 58/252 (23%)
Tryp_SPc 40..256 CDD:238113 59/254 (23%)
AgaP_AGAP005592XP_001237685.2 Tryp_SPc 62..292 CDD:238113 58/250 (23%)
Tryp_SPc 62..289 CDD:214473 56/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.