DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and ctrl

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:286 Identity:83/286 - (29%)
Similarity:118/286 - (41%) Gaps:73/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQG--RITNGYPAEEGKAPYTVGLGFSGGW-WCG 66
            |:..|| |||..|..:|     .:.||    :.|  ||.||..|..|..|:.|.|..|.|: :||
Zfish     5 ISCFAL-VASTLGCGVP-----AIKPV----ISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCG 59

  Fly    67 GSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDFWH 131
            ||:|...||:||.||               |..|.: |:|..|...:.|||:...::       .
Zfish    60 GSLINQYWVVTAAHC---------------RVQAGY-HYVILGEHDRGSSAESVQVK-------S 101

  Fly   132 MVNKVELPSYNDR--YNDY----------------------------NEWWAVACGWGGTYDGSP 166
            :...:..|.||.:  .||.                            :....|..|||.|...|.
Zfish   102 IAKAITHPYYNSQNFNNDITLLKLSSPAQLTSRISPVCLAASSTSIPSGTRCVTTGWGKTGSTSS 166

  Fly   167 LPDYLQCVDLQIIHNSECSGYYGS--VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--LVGVT 227
             |..||...|.::..::|..|:|.  :.|.::|... .|.|:|.||||||||......  .||:.
Zfish   167 -PRILQQTALPLLSPAQCKQYWGQNRITDAMICAGA-SGVSSCQGDSGGPLVCESSGAWYQVGIV 229

  Fly   228 NFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ::|: :.|....||.:.||:|...||
Zfish   230 SWGT-SDCNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/248 (28%)
Tryp_SPc 40..256 CDD:238113 71/249 (29%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 70/248 (28%)
Tryp_SPc 32..257 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.