DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and cela1.6

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:304 Identity:84/304 - (27%)
Similarity:121/304 - (39%) Gaps:88/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF-SGGWW---C 65
            :.||.|:|.:|.....||...|::.       |.|:..|..|.....|:.:.|.: |||.:   |
Zfish     2 LRILLLSVLAALALAEPRYLEEQIA-------QERVVGGEVARPNSWPWQISLQYLSGGSYYHTC 59

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGATWR-------------------TNAQFTHWVGNGNF 111
            ||::|..::||||.||:..:        .|||                   .:..:.|...|.|.
Zfish    60 GGTLIKQNFVLTAAHCVDTS--------RTWRVVLGEHDIYKQEGREQYMTVSNVYIHPNWNRNN 116

  Fly   112 IKHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAV-----------AC---GWGGTY 162
            :. :..||||:|:               |.|...|.|.:...:           ||   |||.|.
Zfish   117 VA-AGYDIALLRL---------------SSNASLNTYVQLGTLPPSGQVLPHNNACYITGWGLTS 165

  Fly   163 DGSPLPDYLQCVDLQIIHNSECS--GYYGSVGDNILCVRTPDGKSTCGGDSGGPL--------VT 217
            .|..|...|:...|.::..:.||  .::||...|.:........|.|.|||||||        |.
Zfish   166 TGGSLSAQLKQAYLPVVDYNTCSRGDWWGSTVKNTMVCAGGGSLSGCQGDSGGPLNCQVSGQYVV 230

  Fly   218 HDGTKLVGVTNFGSVAGCQS-GAPAGFQRVTYHLDWIRDHTGIA 260
            |      |||:|.|.:||.: ..|..|.||:.::.||   .|||
Zfish   231 H------GVTSFVSSSGCNAYQKPTVFTRVSAYISWI---NGIA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/261 (27%)
Tryp_SPc 40..256 CDD:238113 71/263 (27%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.