DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CTRB2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:238 Identity:80/238 - (33%)
Similarity:115/238 - (48%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGW-WCGGSIIAHDWVLTAEHC---------------IGDADS 87
            ||.||..|..|..|:.|.|....|: :||||:|:.|||:||.||               ..|.::
Human    33 RIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEEN 97

  Fly    88 VTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEW 151
            :.|...|....|.:|:....|.        ||.|::: ....|...|:.|.|||.:|   |:...
Human    98 IQVLKIAKVFKNPKFSILTVNN--------DITLLKLATPARFSQTVSAVCLPSADD---DFPAG 151

  Fly   152 WAVA-CGWGGT-YDGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPDGKSTCGGDSGG 213
            ...| .|||.| |:.:..||.||...|.::.|:||...:| .:.|.::|... .|.|:|.|||||
Human   152 TLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGA-SGVSSCMGDSGG 215

  Fly   214 PLVTH-DGT-KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |||.. ||. .|||:.::|| ..|.:..||.:.||...:.|::
Human   216 PLVCQKDGAWTLVGIVSWGS-RTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 79/235 (34%)
Tryp_SPc 40..256 CDD:238113 79/237 (33%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 79/235 (34%)
Tryp_SPc 34..259 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.