Sequence 1: | NP_648217.1 | Gene: | Jon66Cii / 38953 | FlyBaseID: | FBgn0035887 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651783.1 | Gene: | CG9737 / 43600 | FlyBaseID: | FBgn0039758 | Length: | 424 | Species: | Drosophila melanogaster |
Alignment Length: | 268 | Identity: | 68/268 - (25%) |
---|---|---|---|
Similarity: | 103/268 - (38%) | Gaps: | 53/268 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 KDMQGRITNGYPAEEGKAPYTVGLGF-SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR 97
Fly 98 TNAQFT-----HWVGNGNFIKHSSA------------------------DIALIRIPH-VDFWHM 132
Fly 133 VNKVELPSYNDRYNDYNEWWAVACGWGGTYD---------GSPLPDYLQCVDLQIIHNSECS--- 185
Fly 186 -GYYGSVGDNILCVRTPDGKSTCGGDSGGPLV----THDGTKLVGVTNFGSVAGCQSGAPAGFQR 245
Fly 246 VTYHLDWI 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon66Cii | NP_648217.1 | Tryp_SPc | 39..253 | CDD:214473 | 65/261 (25%) |
Tryp_SPc | 40..256 | CDD:238113 | 66/262 (25%) | ||
CG9737 | NP_651783.1 | CLIP | 28..89 | CDD:288855 | |
Tryp_SPc | 149..406 | CDD:214473 | 65/261 (25%) | ||
Tryp_SPc | 150..409 | CDD:238113 | 66/262 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X11 | |
3 | 3.010 |