DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG9737

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:103/268 - (38%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDMQGRITNGYPAEEGKAPYTVGLGF-SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR 97
            |.:..||..|..||..:.|:...|.: |..:.|.|::|....:|||.||: ..:.|....|....
  Fly   144 KQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCV-QGEGVRDRQGLKHV 207

  Fly    98 TNAQFT-----HWVGNGNFIKHSSA------------------------DIALIRIPH-VDFWHM 132
            ...:|.     ..:...|::..:.|                        |||:||:.| |.|.|.
  Fly   208 RLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHF 272

  Fly   133 VNKVELPSYNDRYNDYNEWWAVACGWGGTYD---------GSPLPDYLQCVDLQIIHNSECS--- 185
            |..:.||:.::.............|||.| |         .||:...|:   :..:.|..|:   
  Fly   273 VMPICLPNKSEPLTLAEGQMFSVSGWGRT-DLFNKYFINIHSPIKLKLR---IPYVSNENCTKIL 333

  Fly   186 -GYYGSVGDNILCVRTPDGKSTCGGDSGGPLV----THDGTKLVGVTNFGSVAGCQSGAPAGFQR 245
             |:...:|...:|......|.||.|||||||:    .|......||.::|......:|.||.:..
  Fly   334 EGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTN 398

  Fly   246 VTYHLDWI 253
            |..:.|||
  Fly   399 VAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/261 (25%)
Tryp_SPc 40..256 CDD:238113 66/262 (25%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 65/261 (25%)
Tryp_SPc 150..409 CDD:238113 66/262 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.